PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10008720m
Common NameCICLE_v10008720mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family bZIP
Protein Properties Length: 365aa    MW: 40978.9 Da    PI: 7.0111
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10008720mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1322.6e-10233274950
                      CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   9 rkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                      r   NR +A+rsR RK+++i eLe+ v +L++e +aL  ++ 
  Ciclev10008720m 233 RILANRQSAQRSRVRKLQYISELERSVTTLQTEVSALSPRVA 274
                      6678*****************************999987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.4E-12224289IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.76227279IPR004827Basic-leucine zipper domain
CDDcd147033.51E-22229280No hitNo description
SuperFamilySSF579592.74E-10231281No hitNo description
Gene3DG3DSA:1.20.5.1701.0E-12231280No hitNo description
PfamPF001704.9E-8232274IPR004827Basic-leucine zipper domain
PROSITE patternPS000360233247IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MAQLPPKIPN MSHNWSSFPY QRMSFISSNN NNNNDNNNNN IANAATTMTL NNNNNIHHNQ  60
PHWVDEFLDF SSVRRGAHRR SISDSVAFLD PPSSLVVVEE CRNSNNSNNN NNNSTINNIM  120
SSSDANYCFD RLDDEQLMSM FSDDISVSVP PTASSSNPST PSDQNSNNDE KVTAPSDQQQ  180
QQKQQQQQPK NEPGEVESSC KNNEPSSSQT TTHQTPPASN GDTIIDPKRV KSRILANRQS  240
AQRSRVRKLQ YISELERSVT TLQTEVSALS PRVAFLDHQR LILNVDNSAL KQRIAALAQD  300
KIFKDAHQEA LKKEIERLRQ VYHQQNIKKM KNNNNSNNNA TPPPQQPPSQ PMNTDTIVCM  360
DKDQ*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ccl.23440.0flower
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006451749.10.0hypothetical protein CICLE_v10008720mg
SwissprotQ9M2K41e-104BZP61_ARATH; Basic leucine zipper 61
TrEMBLV4WEK80.0V4WEK8_9R
STRINGPOPTR_0001s38320.11e-120(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17532777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.18e-82bZIP family protein